Structure of PDB 6utw Chain FFF Binding Site BS01

Receptor Information
>6utw Chain FFF (length=277) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV
VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQ
TIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQL
DKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQD
DDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERV
RQIQVEGLRRLREILQTQGLNIEALFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6utw Structural Insights into Transcription Initiation from De Novo RNA Synthesis to Transitioning into Elongation.
Resolution3.854 Å
Binding residue
(original residue number in PDB)		L62 G63 G66 Y67 L70 N98 R100 L101 N111 R129 K133 D135 R138 F140 R141 S143 T144 Y145 T147 W148 W149 Q152 R156 R166 H170
Binding residue
(residue number reindexed from 1)		L10 G11 G14 Y15 L18 N46 R48 L49 N59 R77 K81 D83 R86 F88 R89 S91 T92 Y93 T95 W96 W97 Q100 R104 R114 H118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6utw, PDBe:6utw, PDBj:6utw
PDBsum6utw
PubMed32829286
UniProtP13445|RPOS_ECOLI RNA polymerase sigma factor RpoS (Gene Name=rpoS)

[Back to BioLiP]