Structure of PDB 6sgb Chain FC Binding Site BS01

Receptor Information
>6sgb Chain FC (length=311) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELYVPGQQIIPPGLTRYRVDVQYQGNDFDGWWKSTTRQLFRRERYHARTV
LEEALAVALDVNTVRVVAGVIPEVGVSVRRLCCHVDVPSHIELQPRTVIQ
RATMWMEKRQQPLAILSYRRCKNQDFHARHSGLRRVYVYRILNRVAPPLF
DAGLQWHVDRHLDVDRMKRFAKALEGTKDFGYFADPKMANALRRAANLPT
VRTVDRLDVVRQDDEVLIWFVGRSFLRHQIRNMVSVLKAAGHGLWNDLEL
QQALQSGFEPSRHRFKRERFPTAPAYGLTLWDVEYPDQHRDDYVQFVDSG
PYEQVNIARDI
Ligand information
>6sgb Chain UG (length=17) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPPPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sgb Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S204 T205 T206 R207 Q208 I273 M390 A393 R479 S501 F502 L503 R504
Binding residue
(residue number reindexed from 1)		S34 T35 T36 R37 Q38 I71 M188 A191 R202 S224 F225 L226 R227
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 22 15:42:11 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6sgb', asym_id = 'FC', bs = 'BS01', title = 'Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6sgb', asym_id='FC', bs='BS01', title='Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0001522,0003723,0009451,0009982', uniprot = '', pdbid = '6sgb', asym_id = 'FC'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0001522,0003723,0009451,0009982', uniprot='', pdbid='6sgb', asym_id='FC')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>