Structure of PDB 7fix Chain F1 Binding Site BS01

Receptor Information
>7fix Chain F1 (length=141) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPH
LVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEII
IDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
Ligand information
>7fix Chain X1 (length=28) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTYAFRTFWAVLLLAINFLVAAYYFGIL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fix Structure of cyanobacterial photosystem I complexed with ferredoxin at 1.97 angstrom resolution.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		D77 R79
Binding residue
(residue number reindexed from 1)		D54 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fix, PDBe:7fix, PDBj:7fix
PDBsum7fix
PubMed36097054
UniProtP0A401|PSAF_THEVB Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]