Structure of PDB 9bju Chain F Binding Site BS01

Receptor Information
>9bju Chain F (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHS
YRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKER
CLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9bju Potency-enhanced peptidomimetic VHL ligands with improved oral bioavailability
Resolution2.47 Å
Binding residue
(original residue number in PDB)
P86 W88 F91 Y98 P99 I109 H110 S111 Y112 H115 W117
Binding residue
(residue number reindexed from 1)
P25 W27 F30 Y37 P38 I48 H49 S50 Y51 H54 W56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:9bju, PDBe:9bju, PDBj:9bju
PDBsum9bju
PubMed
UniProtP40337|VHL_HUMAN von Hippel-Lindau disease tumor suppressor (Gene Name=VHL)

[Back to BioLiP]