Structure of PDB 9at8 Chain F Binding Site BS01

Receptor Information
>9at8 Chain F (length=151) Species: 645098 (Measles virus strain Ichinose-B95a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIVHRLEGVSYNIGSQEWYTTVPKYVATQGYLISNFDESSCTFMPEGTVC
SQNALYPMSPLLQECLRGSTKSCARTLVSGSFGNRFILSQGNLIANCASI
LCKCYTTGTIINQDPDKILTYIAADHCPVVEVNGVTIQVGSRRYPDAVYL
H
Ligand information
>9at8 Chain E (length=21) Species: 645098 (Measles virus strain Ichinose-B95a) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QIHWGNLSKIGVVGIGSASYK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9at8 A neutralizing antibody prevents postfusion transition of measles virus fusion protein.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		V294 I295 V296 H297 R298 L299 E300 G301 T313 T321 T341 Y349 L359 R360 G361 S382 Y414
Binding residue
(residue number reindexed from 1)		V1 I2 V3 H4 R5 L6 E7 G8 T20 T28 T48 Y56 L66 R67 G68 S89 Y121
External links
PDB RCSB:9at8, PDBe:9at8, PDBj:9at8
PDBsum9at8
PubMed38935733
UniProtQ786F3|FUS_MEASC Fusion glycoprotein F0 (Gene Name=F)

[Back to BioLiP]