Structure of PDB 8z4l Chain F Binding Site BS01

Receptor Information
>8z4l Chain F (length=194) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPFK
GALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASVD
FLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISN
PQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATD
Ligand information
>8z4l Chain M (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuu
.................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4l Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		G21 E22 K28 F37 R40 P50 K52 G53 R56 S57 T73 S92 M93 R95 A96 T118 H119 L120 R121 I122 R124 K127 F133 G175 W176 L177 N178 K179
Binding residue
(residue number reindexed from 1)		G19 E20 K26 F35 R38 P48 K50 G51 R54 S55 T71 S90 M91 R93 A94 T116 H117 L118 R119 I120 R122 K125 F131 G173 W174 L175 N176 K177
External links