Structure of PDB 8xas Chain F Binding Site BS01

Receptor Information
>8xas Chain F (length=62) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHL
QKYRIYLRRLGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xas The structure of B-ARR reveals the molecular basis of transcriptional activation by cytokinin.
Resolution2.346 Å
Binding residue
(original residue number in PDB)
R19 V43 P44 K45 Q66 R69
Binding residue
(residue number reindexed from 1)
R4 V28 P29 K30 Q51 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8xas, PDBe:8xas, PDBj:8xas
PDBsum8xas
PubMed38198526
UniProtQ940D0|ARR1_ARATH Two-component response regulator ARR1 (Gene Name=ARR1)

[Back to BioLiP]