Structure of PDB 8vdi Chain F Binding Site BS01

Receptor Information
>8vdi Chain F (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vdi Structural Characterization of GC Base Pair Recognition by a Diamidine Small Molecule
Resolution1.93 Å
Binding residue
(original residue number in PDB)		S203 K206 R230 R233 K243 K247 L248
Binding residue
(residue number reindexed from 1)		S35 K38 R62 R65 K75 K79 L80
External links
PDB RCSB:8vdi, PDBe:8vdi, PDBj:8vdi
PDBsum8vdi
PubMed
UniProtP17947|SPI1_HUMAN Transcription factor PU.1 (Gene Name=SPI1)

[Back to BioLiP]