Structure of PDB 8urq Chain F Binding Site BS01

Receptor Information
>8urq Chain F (length=50) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKITCTQDFLHQYFVTERVSIQFGLNNKTVKRINKDEFDKAVNCIMSWTN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8urq Cryo-EM structure of the yeast Spo11 core complex bound to DNA
Resolution3.3 Å
Binding residue
(original residue number in PDB)		T24 R26
Binding residue
(residue number reindexed from 1)		T16 R18
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0007131 reciprocal meiotic recombination
GO:0042138 meiotic DNA double-strand break formation
GO:0051321 meiotic cell cycle
Cellular Component
GO:0000794 condensed nuclear chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8urq, PDBe:8urq, PDBj:8urq
PDBsum8urq
PubMed
UniProtP33323|RE104_YEAST Meiotic recombination protein REC104 (Gene Name=REC104)

[Back to BioLiP]