Structure of PDB 8rkg Chain F Binding Site BS01

Receptor Information
>8rkg Chain F (length=168) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFNL
ENQRLYVADLRLVSQFGSPRISIDTPMICARDSPSCNHATVLIPFFGGVL
TGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRSTLKGDRNDVLVLT
FIYYGKTVPMLISLVCSG
Ligand information
>8rkg Chain P (length=25) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSVVTCTKDSMTVRIPRTLSGFDDE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		F166 W167 L227 S233
Binding residue
(residue number reindexed from 1)		F1 W2 L62 S68
Enzymatic activity
Enzyme Commision number ?
External links