Structure of PDB 8ol1 Chain F Binding Site BS01

Receptor Information
>8ol1 Chain F (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVT
YTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8ol1 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ol1 Nuclear degradation of cGAS is essential for immune homeostasis
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R45 I46 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R24 I25 R57 K58 T59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8ol1, PDBe:8ol1, PDBj:8ol1
PDBsum8ol1
PubMed38418882
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]