Structure of PDB 8jke Chain F Binding Site BS01

Receptor Information
>8jke Chain F (length=301) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATADPVKDYLKQIGKVPLLNAEQEVELAKRIEAGLFAEDKLANSDKLAPK
LKRELEIIAEDGRRAKNHLLEANLRLVVSLAKRYTGRGMLFLDLIQEGNL
GLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVI
NKLARVQRQMLQDLGREPTPEELAKELDMTPEKVIEVQKYGREPISLHTP
LGEDGDSEFGDLIEDSEAVVPADAVSFTLLQEQLHSVLDTLSEREAGVVS
MRFGLTDGQPKTLDEIGKVYGVTRERIRQIESKTMSKLRHPSRSQVLRDY
L
Ligand information
>8jke Chain O (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccggagcgttcagcgttcgtttatctccccctggcactgtcatctccgtc
agaccgtcgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jke Structural and functional characterization of AfsR, a SARP family transcriptional activator of antibiotic biosynthesis in Streptomyces
Resolution3.67 Å
Binding residue
(original residue number in PDB)
V215 K216 R284 L285 K317 F318 D319 K322 Y324 K325 S327 T328 Y329 W332 W333 Q336 R340 R350 H354
Binding residue
(residue number reindexed from 1)
V6 K7 R75 L76 K108 F109 D110 K113 Y115 K116 S118 T119 Y120 W123 W124 Q127 R131 R141 H145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8jke, PDBe:8jke, PDBj:8jke
PDBsum8jke
PubMed38427710
UniProtP18183|SIGA_STRCO RNA polymerase principal sigma factor HrdB (Gene Name=hrdB)

[Back to BioLiP]