Structure of PDB 8j8v Chain F Binding Site BS01

Receptor Information
>8j8v Chain F (length=365) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKV
FVTLTVAFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQER
LLRKLGQHAHPFFFTIPQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKS
LEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASL
DKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADIVLFSTAQYKVPV
AQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTNLASS
TIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDYAT
DDDIVFEDFARLRLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j8v Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors
Resolution3.22 Å
Binding residue
(original residue number in PDB)		Y48 R52 K158 H160 R162
Binding residue
(residue number reindexed from 1)		Y44 R48 K154 H156 R158
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000822 inositol hexakisphosphate binding
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
GO:0031701 angiotensin receptor binding
GO:0035091 phosphatidylinositol binding
Biological Process
GO:0002029 desensitization of G protein-coupled receptor signaling pathway
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0007165 signal transduction
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0031623 receptor internalization
GO:0070374 positive regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0030139 endocytic vesicle
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j8v, PDBe:8j8v, PDBj:8j8v
PDBsum8j8v
PubMed38175886
UniProtP32120|ARRB2_BOVIN Beta-arrestin-2 (Gene Name=ARRB2)

[Back to BioLiP]