Structure of PDB 8ifo Chain F Binding Site BS01

Receptor Information

>8ifo Chain F (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEIT
KRRRKSCQACRFMKCLKVGMLKEGVRL

Ligand information

>8ifo Chain G (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaggacaaaggtgaaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ifo ERR gamma-DBD undergoes dimerization and conformational rearrangement upon binding to the downstream site of the DR1 element
Resolution	2.2 Å
Binding residue (original residue number in PDB)	Y138 H139 Y140 K149 K153 K178 V198 R199
Binding residue (residue number reindexed from 1)	Y15 H16 Y17 K26 K30 K55 V75 R76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8ifo, PDBe:8ifo, PDBj:8ifo
PDBsum	8ifo
PubMed	36944284
UniProt	P62508\|ERR3_HUMAN Estrogen-related receptor gamma (Gene Name=ESRRG)

[Back to BioLiP]