Structure of PDB 8hih Chain F Binding Site BS01

Receptor Information
>8hih Chain F (length=322) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEA
GLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVS
LAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAI
TRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDI
TPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTL
LQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQ
IESKTMSKLRHPSRSQVLRDYL
Ligand information
>8hih Chain K (length=77) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cttcgtcacggcggcgaaacaacgaggggcttccaccgaaaccgcgctgc
gttataatgggagctgtcacggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hih Structural insights into the transcription activation mechanism of the global regulator GlnR from actinobacteria.
Resolution3.66 Å
Binding residue
(original residue number in PDB)		D226 V228 R229 L232 G236 L240 N299 R301 L302 S305 K308 F317 R330 K334 F335 D336 K339 Y341 K342 S344 T345 Y346 T348 W349 W350 Q353 R357 R367 P369 H371 R502
Binding residue
(residue number reindexed from 1)		D21 V23 R24 L27 G31 L35 N94 R96 L97 S100 K103 F112 R125 K129 F130 D131 K134 Y136 K137 S139 T140 Y141 T143 W144 W145 Q148 R152 R162 P164 H166 R297
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hih, PDBe:8hih, PDBj:8hih
PDBsum8hih
PubMed37216560
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]