Structure of PDB 8hdj Chain F Binding Site BS01

Receptor Information
>8hdj Chain F (length=153) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSIGLVIDKKEKVIDAKPLNNDAKPILDEAAPKDMPLYDALSKILDISKK
NGYINSADNIVLFSASINSDKGIQEIISTLKDVAKDAGVKFEIIPSTEED
RQKALDQNLSMGRYAIYVKAVEEGVNLNLEDARNLSVSEILGKVNIGKFA
ISD
Ligand information
>8hdj Chain E (length=11) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEYAYIDVDIN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hdj Essential autoproteolysis of bacterial anti-sigma factor RsgI for transmembrane signal transduction.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		P98 S99 I100 G101 L102 V103 I104 D105 K106 I111 Y150 V158 L159 F160 S161 A162 S163 I164 N165 R206 S215 M216 S241 V242
Binding residue
(residue number reindexed from 1)		P1 S2 I3 G4 L5 V6 I7 D8 K9 I14 Y53 V61 L62 F63 S64 A65 S66 I67 N68 R101 S110 M111 S136 V137
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8hdj, PDBe:8hdj, PDBj:8hdj
PDBsum8hdj
PubMed37418529
UniProtA3DC27|RSGI2_ACET2 Anti-sigma-I factor RsgI2 (Gene Name=rsgI2)

[Back to BioLiP]