Structure of PDB 8h8e Chain F Binding Site BS01

Receptor Information

>8h8e Chain F (length=285) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FSRTCLKNFFSVLLILVYLLLMGVAVFLVYQTITDFRDKLKHPVMSVSYK
EVNMYDAPGIALYPGKARLLSCEHHWYDHIPPLKDPGQPGENTCVTQDIS
YIDPYTNKTMKHALIVQGPRDVRRRELVFLQFHLNETKQDFSAIDYLLFS
SYEAFLKSHDQVKFMQDCESSFSSWKFSGGFRTWVKMSLVKTKEEDGSQS
VEFRQETSVVNFIDRRETPDKGDQLFFVVFEWKDPYIQEIQDIITANPWS
MIALLCSVFLVLFKAADFAKLSVKWMIKVRRRHLK

Ligand information

>8h8e Chain G (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucuucgguaguauaguggucaguauccccgccugucacgcgggagaccgg
gguucgauuccccgccggagagcca

<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>....<<<
<<.......>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8h8e Structure of the dimeric Xenopus tropical acid-sensitive outwardly rectifying channel ASOR trimer bound with tRNA (closed state)
Resolution	3.81 Å
Binding residue (original residue number in PDB)	F58 T61
Binding residue (residue number reindexed from 1)	F1 T4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005254	chloride channel activity
GO:0061797	pH-gated chloride channel activity

	Biological Process
GO:0006821	chloride transport
GO:0034220	monoatomic ion transmembrane transport
GO:1902476	chloride transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0034707	chloride channel complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8h8e, PDBe:8h8e, PDBj:8h8e
PDBsum	8h8e
PubMed	38942816
UniProt	Q0V9Z3\|PACC1_XENTR Proton-activated chloride channel (Gene Name=pacc1)

[Back to BioLiP]