Structure of PDB 8gxb Chain F Binding Site BS01

Receptor Information
>8gxb Chain F (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>8gxb Chain B (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagcguuacguccgaaagucgcauugcacuccgcgacacggcucuuuaa
aaacaaaagga
<<<<<......(((....<<<<<..........>>>>>...>>>>>....
........)))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gxb Structure-based investigations of the NAD+-II riboswitch.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		R46 S47 L48
Binding residue
(residue number reindexed from 1)		R41 S42 L43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8gxb, PDBe:8gxb, PDBj:8gxb
PDBsum8gxb
PubMed36610789
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]