Structure of PDB 8grm Chain F Binding Site BS01

Receptor Information
>8grm Chain F (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIR
DAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8grm Chain I (length=144) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagca
ccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagggg
attactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8grm Synthetic E2-Ub-nucleosome conjugates for studying nucleosome ubiquitination.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R28 I29 S30 G31 R61 K62 T63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8grm, PDBe:8grm, PDBj:8grm
PDBsum8grm
PubMed
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]