Structure of PDB 8gmu Chain F Binding Site BS01

Receptor Information
>8gmu Chain F (length=333) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIA
LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALT
PKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIG
VMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK
IAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ
GKANATAWLKDNPETAKEIEKKVRELLLSNPNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gmu Structural basis for regulation of SOS response in bacteria.
Resolution2.78 Å
Binding residue
(original residue number in PDB)
A168 R169 S172 M197 G212 N213
Binding residue
(residue number reindexed from 1)
A168 R169 S172 M197 G212 N213
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140297 DNA-binding transcription factor binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000725 recombinational repair
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0010212 response to ionizing radiation
GO:0019985 translesion synthesis
GO:0035825 homologous recombination
GO:0048870 cell motility
Cellular Component
GO:0005737 cytoplasm
GO:0009355 DNA polymerase V complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8gmu, PDBe:8gmu, PDBj:8gmu
PDBsum8gmu
PubMed36598938
UniProtP0A7G6|RECA_ECOLI Protein RecA (Gene Name=recA)

[Back to BioLiP]