Structure of PDB 8flj Chain F Binding Site BS01

Receptor Information
>8flj Chain F (length=94) Species: 652611 (Pseudomonas aeruginosa PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPMTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGF
GSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNE
Ligand information
>8flj Chain I (length=139) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aagcttccgacccttttttcggacgatttaaaaaacccttataaatcagc
aagttacgagacctcgaaaaaagagggtttctggcgggaaaaactcaaaa
aacgcttcgaaatcaaccggttataggttttcggagcta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8flj Structure reveals why genome folding is necessary for site-specific integration of foreign DNA into CRISPR arrays.
Resolution3.48 Å
Binding residue
(original residue number in PDB)		E46 R48 P66
Binding residue
(residue number reindexed from 1)		E46 R48 P66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006310 DNA recombination
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8flj, PDBe:8flj, PDBj:8flj
PDBsum8flj
PubMed37710013
UniProtQ02PW7|IHFB_PSEAB Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]