Structure of PDB 8eng Chain F Binding Site BS01

Receptor Information
>8eng Chain F (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eng DNA selection by the master transcription factor PU.1.
Resolution1.25 Å
Binding residue
(original residue number in PDB)		S203 K206 R230 R233 K243 K247 L248
Binding residue
(residue number reindexed from 1)		S35 K38 R62 R65 K75 K79 L80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8eng, PDBe:8eng, PDBj:8eng
PDBsum8eng
PubMed37352101
UniProtP17947|SPI1_HUMAN Transcription factor PU.1 (Gene Name=SPI1)

[Back to BioLiP]