Structure of PDB 8en8 Chain F Binding Site BS01

Receptor Information
>8en8 Chain F (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>8en8 Chain H (length=9) Species: 383583 (Influenza A virus (A/Memphis/101/1972(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPFDKSTIM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8en8 Molecular determinants of cross-strain influenza A virus recognition by T-cell receptors
Resolution2.70001 Å
Binding residue
(original residue number in PDB)
Y7 R62 N63 I66 F67 T73 S77 N80 Y84 Y99 Y123 T143 K146 W147 V152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 R62 N63 I66 F67 T73 S77 N80 Y84 Y99 Y123 T143 K146 W147 V152 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links