Structure of PDB 8e67 Chain F Binding Site BS01

Receptor Information
>8e67 Chain F (length=97) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNH
KNRTNMTYEKMSRALRYYYKLNIIRKEPGQRLLFRFMKTPDEIMSGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e67 The functional role of histidine within the ETV6 ETS domain
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y387 R392 R395 Y398 K405 L411
Binding residue
(residue number reindexed from 1)		Y58 R63 R66 Y69 K76 L82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e67, PDBe:8e67, PDBj:8e67
PDBsum8e67
PubMed
UniProtP97360|ETV6_MOUSE Transcription factor ETV6 (Gene Name=Etv6)

[Back to BioLiP]