Structure of PDB 8d3q Chain F Binding Site BS01

Receptor Information
>8d3q Chain F (length=98) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQL
TSLKLELTSLIDEEKDSLRIYRLGNNYKTKVEHIGAKPSIDLEDPLIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d3q PAM binding ensures orientational integration during Cas4-Cas1-Cas2-mediated CRISPR adaptation.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y7 D8 V9 T11 R33 S37
Binding residue
(residue number reindexed from 1)		Y9 D10 V11 T13 R35 S39
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8d3q, PDBe:8d3q, PDBj:8d3q
PDBsum8d3q
PubMed36272411
UniProtQ9KFX8|CAS2_HALH5 CRISPR-associated endonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]