Structure of PDB 8cn1 Chain F Binding Site BS01

Receptor Information
>8cn1 Chain F (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYEYEEITLERGNSGLGFSIAGGTDNDSSIFITKIITGGAAAQDGRLRVN
DCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKP
Ligand information
>8cn1 Chain R (length=4) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ETEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cn1 Identification of small molecule antivirals against HTLV-1 by targeting the hDLG1-Tax-1 protein-protein interaction.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		G233 L234 F236 S237 I238 T256 K257 H289
Binding residue
(residue number reindexed from 1)		G15 L16 F18 S19 I20 T33 K34 H66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cn1, PDBe:8cn1, PDBj:8cn1
PDBsum8cn1
PubMed37481039
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]