Structure of PDB 8cbl Chain F Binding Site BS01

Receptor Information
>8cbl Chain F (length=294) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKV
KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG
WKGAQAMQFGQPLVFDMAYENYMKRKELQNTVSQLLESEGWNRRNVDPFH
IYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVDLFPKDSIIYLTA
DSPNVMTTFRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYL
QWEIGNKNLTLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLE
Ligand information
>8cbl Chain T (length=86) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaaauauaguuuaaaaacaucagauugugaaucugacaacagaggcuua
cccccuuauuuaccgagaaagccaugcauggcuuuc
<<<<<<<..<<<<..>>>>.<<<<<.......>>>>>....<<.<<....
.>>.>>>>>>>>>...<<<<<<<<<..>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cbl Structural basis for human mitochondrial tRNA maturation.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		N126 T127 Y135 K139 K141 K143 K150 K164 F177 F179 R181 L182 D184 R185 K218 N222 L228 E229 R235 R236 R261 K265 K315 M317 E345 I346 G347 N348 D354 Q355 K378 R379
Binding residue
(residue number reindexed from 1)		N34 T35 Y43 K47 K49 K51 K58 K72 F85 F87 R89 L90 D92 R93 K126 N130 L136 E137 R143 R144 R169 K173 K223 M225 E253 I254 G255 N256 D262 Q263 K286 R287
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.218: tRNA (adenine(9)-N(1))-methyltransferase.
2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0042802 identical protein binding
GO:0052905 tRNA (guanosine(9)-N1)-methyltransferase activity
GO:0160106 tRNA (adenine(9)-N1)-methyltransferase activity
Biological Process
GO:0000964 mitochondrial RNA 5'-end processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0032259 methylation
GO:0070131 positive regulation of mitochondrial translation
GO:0070901 mitochondrial tRNA methylation
GO:0090646 mitochondrial tRNA processing
GO:0097745 mitochondrial tRNA 5'-end processing
GO:1990180 mitochondrial tRNA 3'-end processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0030678 mitochondrial ribonuclease P complex
GO:0042645 mitochondrial nucleoid
GO:0043527 tRNA methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cbl, PDBe:8cbl, PDBj:8cbl
PDBsum8cbl
PubMed38824131
UniProtQ7L0Y3|TM10C_HUMAN tRNA methyltransferase 10 homolog C (Gene Name=TRMT10C)

[Back to BioLiP]