Structure of PDB 8bya Chain F Binding Site BS01

Receptor Information
>8bya Chain F (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGW
VHYMIHEPEPHILLFRRPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bya Cryo-EM structure of SKP1-SKP2-CKS1 in complex with CDK2-cyclin A-p27KIP1.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		Y3008 R3044 Q3049 S3051 Q3052
Binding residue
(residue number reindexed from 1)		Y4 R40 Q45 S47 Q48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019901 protein kinase binding
GO:0042393 histone binding
GO:0043130 ubiquitin binding
GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007346 regulation of mitotic cell cycle
GO:0044772 mitotic cell cycle phase transition
GO:0048144 fibroblast proliferation
GO:0051301 cell division
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0005654 nucleoplasm
GO:0019005 SCF ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bya, PDBe:8bya, PDBj:8bya
PDBsum8bya
PubMed37400515
UniProtP61024|CKS1_HUMAN Cyclin-dependent kinases regulatory subunit 1 (Gene Name=CKS1B)

[Back to BioLiP]