Structure of PDB 8bv1 Chain F Binding Site BS01

Receptor Information

>8bv1 Chain F (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE
EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTY
RGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHI
NWED

Ligand information

>8bv1 Chain G (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EKIARLARRIA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8bv1 Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.
Resolution	2.834 Å
Binding residue (original residue number in PDB)	Y112 R145
Binding residue (residue number reindexed from 1)	Y111 R144

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bv1, PDBe:8bv1, PDBj:8bv1
PDBsum	8bv1
PubMed	37347155
UniProt	Q9Y294\|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]