Structure of PDB 8bbk Chain F Binding Site BS01

Receptor Information
>8bbk Chain F (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQ
YDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKG
LLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRA
DVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGT
SLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGV
ESLVELLGWTEEMRDLVQRETGKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bbk Molecular Mechanism of Sirtuin 1 Modulation by the AROS Protein.
Resolution3.27 Å
Binding residue
(original residue number in PDB)		H248 V292 F294 E296 L298
Binding residue
(residue number reindexed from 1)		H128 V172 F174 E176 L178
Enzymatic activity
Enzyme Commision number 2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0003950 NAD+-protein poly-ADP-ribosyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0019899 enzyme binding
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0070403 NAD+ binding
GO:1990404 NAD+-protein ADP-ribosyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006476 protein deacetylation
GO:0009060 aerobic respiration
GO:0032024 positive regulation of insulin secretion
GO:0034983 peptidyl-lysine deacetylation
GO:0070373 negative regulation of ERK1 and ERK2 cascade
GO:1901671 positive regulation of superoxide dismutase activity
GO:1902553 positive regulation of catalase activity
GO:2000304 positive regulation of ceramide biosynthetic process
GO:2000378 negative regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bbk, PDBe:8bbk, PDBj:8bbk
PDBsum8bbk
PubMed36361557
UniProtQ9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)

[Back to BioLiP]