Structure of PDB 8ari Chain F Binding Site BS01

Receptor Information
>8ari Chain F (length=331) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMY
HTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVE
ETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGET
LGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDL
LFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALA
QALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIE
MREEAAREIRRAITGRIPDSLKNCVNKDHLT
Ligand information
>8ari Chain b (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EALDLSMKSVPWLKAGALDLSV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ari Cryo-EM structure of human CtBP1/RAI2(303-362) delta(331-341) filament
Resolution3.0 Å
Binding residue
(original residue number in PDB)		A52 F53 C54 H63
Binding residue
(residue number reindexed from 1)		A26 F27 C28 H37
Enzymatic activity
Enzyme Commision number 1.1.1.-
Gene Ontology
Molecular Function
GO:0001221 transcription coregulator binding
GO:0001222 transcription corepressor binding
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0051287 NAD binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006468 protein phosphorylation
GO:0008285 negative regulation of cell population proliferation
GO:0019079 viral genome replication
GO:0030154 cell differentiation
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0048488 synaptic vesicle endocytosis
GO:0050872 white fat cell differentiation
GO:0051726 regulation of cell cycle
GO:0097091 synaptic vesicle clustering
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0017053 transcription repressor complex
GO:0098831 presynaptic active zone cytoplasmic component
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ari, PDBe:8ari, PDBj:8ari
PDBsum8ari
PubMed
UniProtQ13363|CTBP1_HUMAN C-terminal-binding protein 1 (Gene Name=CTBP1)

[Back to BioLiP]