Structure of PDB 8amu Chain F Binding Site BS01

Receptor Information
>8amu Chain F (length=132) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QAKEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQK
YKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYL
THESKDAIAKKKHVYDKADIKLINNFDIDRYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8amu Structures of pMV158 replication initiator RepB with and without DNA reveal a flexible dual-function protein.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D69 R72 M86 V87 Q88
Binding residue
(residue number reindexed from 1)		D69 R72 M86 V87 Q88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003916 DNA topoisomerase activity
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005727 extrachromosomal circular DNA

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8amu, PDBe:8amu, PDBj:8amu
PDBsum8amu
PubMed36688326
UniProtP13921|REPB_STRAG Replication protein RepB (Gene Name=repB)

[Back to BioLiP]