Structure of PDB 8ab0 Chain F Binding Site BS01

Receptor Information

>8ab0 Chain F (length=152) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PESLLKLTRALSRLPGIGPKTAQRLALHLAFHKEEAEALAEALEVRACRE
CGNLAEGELCPICQSLLAVVESVADLYALERSGEFRGLYHVLGGALNPLE
GIGPKELNLEGLFRRLEGVEEVVLATSMTVEGEATALYLAEELKKRGVRV
TR

Ligand information

>8ab0 Chain X (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggccagat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ab0 Mechanism of RecF-RecO-RecR cooperation in bacterial homologous recombination.
Resolution	6.09 Å
Binding residue (original residue number in PDB)	I20 G21
Binding residue (residue number reindexed from 1)	I17 G18

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006281	DNA repair
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8ab0, PDBe:8ab0, PDBj:8ab0
PDBsum	8ab0
PubMed	37081315
UniProt	Q5SHY0\|RECR_THET8 Recombination protein RecR (Gene Name=recR)

[Back to BioLiP]