Structure of PDB 7zxy Chain F Binding Site BS01

Receptor Information
>7zxy Chain F (length=36) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTAESMLANGAFIMIGLTLLGLAWGFVIIKLQGSEE
Ligand information
>7zxy Chain H (length=29) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDILTLGWVSVLVLFTWSISMVVWGRNGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		M1 T2 M6 M14 L17 T18 G21 L22 W24 G25 F26 I28 I29 Q32
Binding residue
(residue number reindexed from 1)		M1 T2 M6 M14 L17 T18 G21 L22 W24 G25 F26 I28 I29 Q32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
PDBsum7zxy
PubMed35726684
UniProtP74810|PETM_SYNY3 Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]