Structure of PDB 7zgp Chain F Binding Site BS01

Receptor Information
>7zgp Chain F (length=46) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIRRTTGIPKKFLKSIEMITDEGKFVVQVEDKQSWEDYQRKRENRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zgp Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T212 I214 P215 K216
Binding residue
(residue number reindexed from 1)		T6 I8 P9 K10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000209 protein polyubiquitination
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016567 protein ubiquitination
GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zgp, PDBe:7zgp, PDBj:7zgp
PDBsum7zgp
PubMed35584695
UniProtP35728|MPE1_YEAST Protein MPE1 (Gene Name=MPE1)

[Back to BioLiP]