Structure of PDB 7yr7 Chain F Binding Site BS01

Receptor Information

>7yr7 Chain F (length=55) Species: 287 (Pseudomonas aeruginosa)

MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQR
IQKEK

Ligand information

>7yr7 Chain A (length=118)

gcguacagggaacacgcaaccccgaaggaucggggaagggacgucgccag
ggaggcgauuccaucaggaugaugacgagggacugaagagugggcggggu
aauaccccgccccuuuuu

<<<<.........>>>>..<<<<<......>>>>>.......<<<<<...
....>>>>>...<<<.....>>>............<<<<<.<<<<<<<<.
....>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7yr7 Structural basis of sRNA RsmZ regulation of Pseudomonas aeruginosa virulence.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): M1 I3 L4 T5 R7 G27 R31 K38 V42 H43 R44 Y48
• Binding residue (residue number reindexed from 1): M1 I3 L4 T5 R7 G27 R31 K38 V42 H43 R44 Y48

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0006109 regulation of carbohydrate metabolic process
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0009372 quorum sensing
• GO:0030254 protein secretion by the type III secretion system
• GO:0033103 protein secretion by the type VI secretion system
• GO:0043455 regulation of secondary metabolic process
• GO:0045947 negative regulation of translational initiation
• GO:0045948 positive regulation of translational initiation
• GO:1900190 regulation of single-species biofilm formation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7yr7, PDBe:7yr7, PDBj:7yr7
• PDBsum: 7yr7
• PubMed: 36828938
• UniProt: O69078|CSRA_PSEAE Translational regulator CsrA (Gene Name=csrA)