Structure of PDB 7x5f Chain F Binding Site BS01

Receptor Information
>7x5f Chain F (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIR
RRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHL
LKKQLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x5f Structural basis of transcription regulation by CNC family transcription factor, Nrf2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R504 N507 K508 R515
Binding residue
(residue number reindexed from 1)		R52 N55 K56 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7x5f, PDBe:7x5f, PDBj:7x5f
PDBsum7x5f
PubMed36454022
UniProtQ16236|NF2L2_HUMAN Nuclear factor erythroid 2-related factor 2 (Gene Name=NFE2L2)

[Back to BioLiP]