Structure of PDB 7w3b Chain F Binding Site BS01

Receptor Information
>7w3b Chain F (length=395) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIK
ENSEKIKVNKTLPYLVSNVIELLDVKCAVIKTSTRQTYFLPVIGLVDAEK
LKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQ
IQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQT
KATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTK
RFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLR
SGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGA
QCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA
Ligand information
>7w3b Chain v (length=28) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w3b USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
M259 F260 E299 A301 E305
Binding residue
(residue number reindexed from 1)
M215 F216 E255 A257 E261
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0036402 proteasome-activating activity
GO:0042802 identical protein binding
Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043921 modulation by host of viral transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1901800 positive regulation of proteasomal protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0000932 P-body
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0008540 proteasome regulatory particle, base subcomplex
GO:0016020 membrane
GO:0022624 proteasome accessory complex
GO:0034774 secretory granule lumen
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7w3b, PDBe:7w3b, PDBj:7w3b
PDBsum7w3b
PubMed35477760
UniProtP17980|PRS6A_HUMAN 26S proteasome regulatory subunit 6A (Gene Name=PSMC3)

[Back to BioLiP]