Structure of PDB 7vpz Chain F Binding Site BS01

Receptor Information
>7vpz Chain F (length=301) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATADPVKDYLKQIGKVPLLNAEQEVELAKRIEAGLFAEDKLANSDKLAPK
LKRELEIIAEDGRRAKNHLLEANLRLVVSLAKRYTGRGMLFLDLIQEGNL
GLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVI
NKLARVQRQMLQDLGREPTPEELAKELDMTPEKVIEVQKYGREPISLHTP
LGEDGDSEFGDLIEDSEAVVPADAVSFTLLQEQLHSVLDTLSEREAGVVS
MRFGLTDGQPKTLDEIGKVYGVTRERIRQIESKTMSKLRHPSRSQVLRDY
L
Ligand information
>7vpz Chain O (length=84) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caaggcacatgacaacggtgttcagtgccgcgttgcccgataccccctac
ccgtagttgactggcatccgggcgccgggtcgcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vpz Structural basis of Streptomyces transcription activation by zinc uptake regulator.
Resolution4.14 Å
Binding residue
(original residue number in PDB)		V215 K216 L219 L227 A281 N282 R284 L285 K291 F300 K317 K322 Y324 K325 T328 T331 W332 Q336 P352 H354 R453 T482 E484 R485
Binding residue
(residue number reindexed from 1)		V6 K7 L10 L18 A72 N73 R75 L76 K82 F91 K108 K113 Y115 K116 T119 T122 W123 Q127 P143 H145 R244 T273 E275 R276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vpz, PDBe:7vpz, PDBj:7vpz
PDBsum7vpz
PubMed35871291
UniProtP18183|SIGA_STRCO RNA polymerase principal sigma factor HrdB (Gene Name=hrdB)

[Back to BioLiP]