Structure of PDB 7v8q Chain F Binding Site BS01

Receptor Information
>7v8q Chain F (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLLQSGGGLVQPGGSLKLSCAASGIDFSGYWMSWVRRAPGKGLEWIGE
ITPDSSTINYAPSLKDEFIISRDNAKNTLYLQMTKVRSDDTALYYCVSYY
EGFAYWGQGTLVTVSAASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEPKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v8q Site-specific GalNAc modification on a MUC1 neoantigen epitope forms a basis for high-affinity antibody binding
Resolution3.2 Å
Binding residue
(original residue number in PDB)
G32 Y33 W34 E51 Y100 Y101 E102
Binding residue
(residue number reindexed from 1)
G31 Y32 W33 E50 Y99 Y100 E101
External links