Structure of PDB 7v5n Chain F Binding Site BS01

Receptor Information
>7v5n Chain F (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGW
INTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYP
HYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v5n Development of a DNA aptamer that binds to the complementarity-determining region of therapeutic monoclonal antibody and affinity improvement induced by pH-change for sensitive detection.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		T30 N31 Y32 G33 W50 N52 T53 Y54 T55 Y99 H101 Y102 Y103 G104 S105 W108
Binding residue
(residue number reindexed from 1)		T30 N31 Y32 G33 W50 N52 T53 Y54 T55 Y99 H101 Y102 Y103 G104 S105 W108
External links