Structure of PDB 7unr Chain F Binding Site BS01

Receptor Information
>7unr Chain F (length=176) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIEN
AVADLEKITGQKPVVTYARKSIAGFKIREGWPIGVKVTLRSDRMYEFLDR
LLSISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGL
DITLTTTARTDDEGRALLRAFKFPFR
Ligand information
>7unr Chain v (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgggguggagcagccugguagcucgucgggcucauaacccgaaggucgu
cgguucaaauccggcccccgcaacca
<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S73 A75 R80
Binding residue
(residue number reindexed from 1)		S71 A73 R78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9HWE7|RL5_PSEAE Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]