Structure of PDB 7ubn Chain F Binding Site BS01

Receptor Information
>7ubn Chain F (length=353) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPE
AITYLLEQYDRVEAEEARLSDLITGFELAREKFAELRAQYVVTRDTIKAH
ATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCV
EQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQ
KLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAK
KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRS
IADQATAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALR
KLR
Ligand information
>7ubn Chain 1 (length=53) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tattgaataaaattgggtaaatttgacactataatgggttcgctcgttgt
ggt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ubn In transcription antitermination by Q lambda , NusA induces refolding of Q lambda to form a nozzle that extends the RNA polymerase RNA-exit channel.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		D96 V98 R99 G106 L110 N383 R385 S389 K392 E420 R423 Y425 K426 S428 T429 Y430 T432 W433 T583 R586 Q589
Binding residue
(residue number reindexed from 1)		D7 V9 R10 G17 L21 N241 R243 S247 K250 E278 R281 Y283 K284 S286 T287 Y288 T290 W291 T337 R340 Q343
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009408 response to heat
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ubn, PDBe:7ubn, PDBj:7ubn
PDBsum7ubn
PubMed35951650
UniProtP00579|RPOD_ECOLI RNA polymerase sigma factor RpoD (Gene Name=rpoD)

[Back to BioLiP]