Structure of PDB 7sg1 Chain F Binding Site BS01

Receptor Information
>7sg1 Chain F (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVL
RQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTL
GQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKIS
YLTLLPSAEESYDCKVEHWGLDKPLLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sg1 Structural basis of T cell receptor specificity and cross-reactivity of two HLA-DQ2.5-restricted gluten epitopes in celiac disease.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R52 F54 F58 N62 V65 H68 N69 N71 S72
Binding residue
(residue number reindexed from 1)		R54 F55 F59 N63 V66 H69 N70 N72 S73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sg1, PDBe:7sg1, PDBj:7sg1
PDBsum7sg1
PubMed35065967
UniProtP01909|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]