Structure of PDB 7s81 Chain F Binding Site BS01

Receptor Information
>7s81 Chain F (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFS
CFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s81 Captured snapshots of PARP1 in the active state reveal the mechanics of PARP1 allostery.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		S16 A19 S20 R34 V48
Binding residue
(residue number reindexed from 1)		S11 A14 S15 R29 V43
Enzymatic activity
Enzyme Commision number 2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:7s81, PDBe:7s81, PDBj:7s81
PDBsum7s81
PubMed35793673
UniProtP09874|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 (Gene Name=PARP1)

[Back to BioLiP]