Structure of PDB 7rwi Chain F Binding Site BS01

Receptor Information
>7rwi Chain F (length=174) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQ
HPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPEQST
PDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEG
TVKSRLHYAVRALRLTLQELGVTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rwi Design, Synthesis, and Characterization of TNP-2198, a Dual-Targeted Rifamycin-Nitroimidazole Conjugate with Potent Activity against Microaerophilic and Anaerobic Bacterial Pathogens.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		V25 R28 L31 R32 R50 E56 R63 P64 A67 W68 F70 V72 N75
Binding residue
(residue number reindexed from 1)		V22 R25 L28 R29 R47 E53 R60 P61 A64 W65 F67 V69 N72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7rwi, PDBe:7rwi, PDBj:7rwi
PDBsum7rwi
PubMed35175750
UniProtP9WGH5|SIGL_MYCTU ECF RNA polymerase sigma factor SigL (Gene Name=sigL)

[Back to BioLiP]