Structure of PDB 7rdq Chain F Binding Site BS01

Receptor Information
>7rdq Chain F (length=349) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDP
DLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYL
HIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAV
EKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRT
ARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDE
KDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKG
LIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rdq Structural and mechanistic basis of reiterative transcription initiation.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		V81 L85 G89 R193 L194 K200 F209 R222 K226 R231 F233 K234 S236 T237 Y238 T240 W242 Q245 R249 R259 P261 H263
Binding residue
(residue number reindexed from 1)		V7 L11 G15 R119 L120 K126 F135 R148 K152 R157 F159 K160 S162 T163 Y164 T166 W168 Q171 R175 R185 P187 H189
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rdq, PDBe:7rdq, PDBj:7rdq
PDBsum7rdq
PubMed35082149
UniProtQ5SKW1

[Back to BioLiP]