Structure of PDB 7qgg Chain F Binding Site BS01

Receptor Information
>7qgg Chain F (length=294) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIV
RVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGL
LLARRLLNRFGMDKIYEGQVEVNGDEYNVESIDGQPGAFTCYLDAGLART
TTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQN
VADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVY
EKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES
Ligand information
>7qgg Chain E (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		K10 F13 K14 Y16 V18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 R58 I69 D72 M73 I74 N94 R152 T155 N157 K158 N203 V204 Y207 Q222 F223 S224 Q225 Y226 Y253 K255 K256 R259 V261 W266 R268 P269 K270 M271 L273 K276 K277 R279 V280
Binding residue
(residue number reindexed from 1)		K7 F10 K11 Y13 V15 F17 R18 R19 R21 T25 Y27 R30 R47 R51 T53 N54 R55 I66 D69 M70 I71 N91 R149 T152 N154 K155 N200 V201 Y204 Q219 F220 S221 Q222 Y223 Y250 K252 K253 R256 V258 W263 R265 P266 K267 M268 L270 K273 K274 R276 V277
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
GO:0031625 ubiquitin protein ligase binding
GO:0048027 mRNA 5'-UTR binding
GO:1990948 ubiquitin ligase inhibitor activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006364 rRNA processing
GO:0006412 translation
GO:0010628 positive regulation of gene expression
GO:0042273 ribosomal large subunit biogenesis
GO:0045727 positive regulation of translation
GO:0050821 protein stabilization
GO:1901796 regulation of signal transduction by p53 class mediator
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
GO:2000435 negative regulation of protein neddylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0017101 aminoacyl-tRNA synthetase multienzyme complex
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0032991 protein-containing complex
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum7qgg
PubMed36038000
UniProtP09895|RL5_RAT Large ribosomal subunit protein uL18 (Gene Name=Rpl5)

[Back to BioLiP]