Structure of PDB 7q4o Chain F Binding Site BS01

Receptor Information
>7q4o Chain F (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAY
VVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKM
Ligand information
>7q4o Chain 2 (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaguguaguaucuguucuuaucaguuuaauaucug
.....................<<<........>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4o Structural basis of branch site recognition by the human spliceosome.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E16 Y22 R24 Y61 R96
Binding residue
(residue number reindexed from 1)		E5 Y11 R13 Y50 R85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0001825 blastocyst formation
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q4o, PDBe:7q4o, PDBj:7q4o
PDBsum7q4o
PubMed34822310
UniProtQ9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 (Gene Name=SF3B6)

[Back to BioLiP]