Structure of PDB 7p0u Chain F Binding Site BS01

Receptor Information
>7p0u Chain F (length=129) Species: 10258 (Orf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQE
LSNANSHIPAALVSALLEATSPGRMVTAVELCAQMGRLWTRGRQLVDFMR
LVYVLLDRLPPTADEDLGAWLQAVARVHG
Ligand information
>7p0u Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAAQLTAARLKALGDELHQRT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0u Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk.
Resolution1.99374 Å
Binding residue
(original residue number in PDB)		E46 P50 E54 A77 L78 G86 R87 W133 V137 H141
Binding residue
(residue number reindexed from 1)		E42 P46 E50 A65 L66 G73 R74 W120 V124 H128
Enzymatic activity
Enzyme Commision number ?
External links